Protein Info for PS417_08170 in Pseudomonas simiae WCS417

Annotation: capsular biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF01370: Epimerase" amino acids 3 to 186 (184 residues), 85.8 bits, see alignment E=9.8e-28 PF16363: GDP_Man_Dehyd" amino acids 84 to 203 (120 residues), 30.6 bits, see alignment E=7.5e-11 PF14667: Polysacc_synt_C" amino acids 255 to 364 (110 residues), 163 bits, see alignment E=7.1e-52

Best Hits

Swiss-Prot: 65% identical to WBJC_PSEA1: UDP-2-acetamido-2,6-beta-L-arabino-hexul-4-ose reductase (wbjC) from Pseudomonas aeruginosa (strain ATCC 29260 / BCRC 12902 / CIP 102967 / NCIMB 11965 / PA103)

KEGG orthology group: None (inferred from 73% identity to ppg:PputGB1_1374)

MetaCyc: 66% identical to UDP-N-acetyl-beta-L-pneumosamine dehydrogenase (Pseudomonas aeruginosa O11)
RXN-14994 [EC: 1.1.1.367]

Predicted SEED Role

"WbjC"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.367

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6V0 at UniProt or InterPro

Protein Sequence (372 amino acids)

>PS417_08170 capsular biosynthesis protein (Pseudomonas simiae WCS417)
MKVLITGANGFVGRNLIAHLSERNDIDVVAFTRDNSISQLPALVAEVDFVFHLAGVNRPQ
SSDEFKVGNTDLTLALCDAIKMSGKPTPVLYTSSTQADRDNPYGISKLAAEHALHDLQAS
HGSKVHVLRLPNVFGKWARPDYNSAVATFCHNITRGLPIQVNDRHAMVSLVYIDDVVDCF
TQLMDAGSPQDSVAQVSPVYSISVGELADQLHAFRDSRDTLISEAVGTGLVRALYSTYVS
YLPVEQFTYDVPKYGDPRGVFVEMLKTRDSGQFSYFTAHPGVTRGGHYHHSKTEKFLVIK
GKACFRFRHIVSGEFYELFTEGEQPRIVETVPGWTHDITNVGEEEMIVMLWANEIFDRER
PDTFAMPVGTQA