Protein Info for GFF1606 in Sphingobium sp. HT1-2

Annotation: Apolipoprotein N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 159 to 185 (27 residues), see Phobius details amino acids 192 to 209 (18 residues), see Phobius details amino acids 489 to 508 (20 residues), see Phobius details PF20154: LNT_N" amino acids 16 to 180 (165 residues), 104.4 bits, see alignment E=7.3e-34 TIGR00546: apolipoprotein N-acyltransferase" amino acids 60 to 460 (401 residues), 269.5 bits, see alignment E=2.8e-84 PF00795: CN_hydrolase" amino acids 222 to 468 (247 residues), 73.3 bits, see alignment E=2.1e-24

Best Hits

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-)" in subsystem Phosphate metabolism (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>GFF1606 Apolipoprotein N-acyltransferase (Sphingobium sp. HT1-2)
MNALLARHPRLAALLAGFLSATGFEPLKLWPVTIGCFALLILLIERAPDRRAAFLRGWLF
GVGHFTLGLNWIAHAFTYQDAMPHWFGYGAVVLLSLYLAVYPGLATLGAWWAGRRFALTG
PAFLLLFAGCWIASEYARATIFTGFAWNPLGVTLLPTGAAITATLIGTYGLGALVLLAAG
ACLLAARRQYRPAAVIAVPLVVLALWGQLSPAPTTPAGAPLIRVVQPNIGQDEKYSAELE
QAHFRTLATLSGQPRPAPRLIFWPEAAIPAYLDMEPEWRWRLADLMGPGDLLMTGATKVY
FKDKGPYGTTELAGANNSLFVVTPDAQLAARYDKAHLVPYGEYLPMRSILQPIGLSRLVP
GDVDFWPGPGPQSLTLPATLGRPALKMGVQICYEIIFSGQVVDRANRPDFLFNPSNDAWF
GSWGPVQHLAQARLRALEEGLPIIRATPTGVSAIVDARGHILHALSSHRAGYLDSRLPPP
LPATLFARIGNWAPFAFLILLIGTAIALRKGKS