Protein Info for PS417_08165 in Pseudomonas simiae WCS417

Annotation: UDP-glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 PF05368: NmrA" amino acids 5 to 207 (203 residues), 33.8 bits, see alignment E=1.5e-11 PF04321: RmlD_sub_bind" amino acids 6 to 125 (120 residues), 33.3 bits, see alignment E=1.5e-11 PF08659: KR" amino acids 6 to 123 (118 residues), 26.2 bits, see alignment E=3.6e-09 PF02719: Polysacc_synt_2" amino acids 7 to 282 (276 residues), 353 bits, see alignment E=6.1e-109 PF01370: Epimerase" amino acids 8 to 219 (212 residues), 91.8 bits, see alignment E=2.3e-29 PF16363: GDP_Man_Dehyd" amino acids 8 to 243 (236 residues), 59.8 bits, see alignment E=1.6e-19 PF01073: 3Beta_HSD" amino acids 8 to 130 (123 residues), 71.2 bits, see alignment E=4e-23 PF07993: NAD_binding_4" amino acids 9 to 145 (137 residues), 31.5 bits, see alignment E=5.4e-11 PF13460: NAD_binding_10" amino acids 11 to 150 (140 residues), 49.1 bits, see alignment E=3.2e-16 PF08485: Polysacc_syn_2C" amino acids 285 to 332 (48 residues), 81.9 bits, see alignment 1.1e-26

Best Hits

Swiss-Prot: 66% identical to CAPD_RICAH: UDP-glucose 4-epimerase (capD) from Rickettsia akari (strain Hartford)

KEGG orthology group: None (inferred from 91% identity to pen:PSEEN1500)

MetaCyc: 84% identical to UDP-N-acetylglucosamine 4,6-dehydratase (configuration-inverting) (Pseudomonas aeruginosa O11)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEZ6 at UniProt or InterPro

Protein Sequence (344 amino acids)

>PS417_08165 UDP-glucose 4-epimerase (Pseudomonas simiae WCS417)
MFSGKTLLITGGTGSFGNAVLKRFLDSGIAEIRIFSRDEKKQDDMRKRYADTKLKFYIGD
VRDYQSVLNATRGVDYIFHAAALKQVPSCEFHPMEAVKTNVIGTENVLEAAIQNSVKRVV
CLSTDKAVYPINAMGISKAMMEKVMIAKSRNVDDAKTVICGTRYGNVMASRGSVIPLFIE
QIRAGNALTLTDPSMTRFMMTLADAVDLVLYAFEHGRNGDLFVQKAPAATVETLAKALTA
MVGKPEHPIQVIGTRHGEKLFEALLSREEMACAEDKGDYYRIPPDLRDLNYSKFVEQGEE
KISRTEDYNSHNTERLDVAGMQRLLLKLEFMKAIQRGELATPEE