Protein Info for GFF1605 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Ankyrin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF12796: Ank_2" amino acids 25 to 87 (63 residues), 38.7 bits, see alignment E=3.1e-13 amino acids 96 to 189 (94 residues), 48.9 bits, see alignment E=2e-16 PF00023: Ank" amino acids 27 to 54 (28 residues), 16.6 bits, see alignment (E = 2.1e-06) amino acids 57 to 87 (31 residues), 25.7 bits, see alignment 2.6e-09 amino acids 123 to 153 (31 residues), 15.5 bits, see alignment 4.5e-06 amino acids 156 to 191 (36 residues), 15.5 bits, see alignment 4.6e-06 PF13637: Ank_4" amino acids 130 to 165 (36 residues), 29.1 bits, see alignment 2.5e-10

Best Hits

Swiss-Prot: 39% identical to YAHD_ECOLI: Putative ankyrin repeat protein YahD (yahD) from Escherichia coli (strain K12)

KEGG orthology group: K06867, (no description) (inferred from 74% identity to put:PT7_0521)

Predicted SEED Role

"Ankyrin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>GFF1605 Ankyrin (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLRRSMLFSFAVLPFASSGSEPATPFPLHAAASRNDAAGIRQLLAGGAKIDARDGSGATA
LLVATHANQVEAARALIEAGADVNAKDGISDSPYLYAGARGHLAILKMTLSHGADLKSTN
RYGGTALIPAAERGHVETVRTLIEAGVAVDHVNRLGWTALLEAVILGDGSERYQQIVGLL
LKAGANAQLADNQGVTPLQHARTKGQKAIEAMLQAAPR