Protein Info for GFF1604 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Probable deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00383: dCMP_cyt_deam_1" amino acids 1 to 101 (101 residues), 84.1 bits, see alignment E=5.7e-28 PF14437: MafB19-deam" amino acids 3 to 107 (105 residues), 77.3 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 38% identical to GUAD_BACSU: Guanine deaminase (guaD) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 71% identity to rme:Rmet_3722)

Predicted SEED Role

"Probable deaminase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>GFF1604 Probable deaminase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNDEERFLQQAIELARANIEQGGRPFGAVVVRGGEVLATGVNEILATQDPTAHAEMSALR
AASRRLGSPDLSGCSVYASGHPCPMCMAAMRLAGVGRVAYAYSNEEGAPFGLSTAAVYED
LAQPFAEQSMDIRHLPVPRPELYAQWAQAQNRKA