Protein Info for GFF1603 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cyanate transport protein CynX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 62 (22 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 128 to 153 (26 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 342 (331 residues), 100.8 bits, see alignment E=7.8e-33

Best Hits

KEGG orthology group: K03449, MFS transporter, CP family, cyanate transporter (inferred from 59% identity to har:HEAR0884)

Predicted SEED Role

"Cyanate transport protein CynX" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>GFF1603 Cyanate transport protein CynX (Hydrogenophaga sp. GW460-11-11-14-LB1)
VTVNARWLLLAVALIALNLRPFMAGIGPLAADIGPHTGLGLRGLALLTLVPMLLMGVFAF
AGPWLQGRFGARRAVVAALVLLAVGSALRLFTQSGWQLVGTAALLGLGAAVVQALLPGIV
KRQFPRHVGVVMGLYSAMLMGGGALGAQVAPLAAAAGGDWHWGLAWMALPATLAVVLAAR
SLPRDGVDHQGTLAVAAYLRRPRVWLLMLCFGLVNGGYSTVVAWLAPFYQEHGWSAAASG
SLLAVLALCQAAAALLLPMLAGRREDRRPWLWFTLALQATGFTALALWPDAAPVAGVMLL
GAGLGGCFALSLIVALEHLPDPAQAGALSALMQGGGFLLAAIPPWIVAVLRDATGGFQAG
WLMHLACVAIVTVLYVRVAPASYAGAIRLVPRAT