Protein Info for PS417_08110 in Pseudomonas simiae WCS417

Annotation: methylthioribose-1-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase
  • amino acids 12 to 341 (330 residues), 420.7 bits, E=3.7e-130
• TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins
  • amino acids 38 to 341 (304 residues), 317.1 bits, E=1e-98
• PF01008: IF-2B
  • amino acids 53 to 341 (289 residues), 243.3 bits, E=1.5e-76

Best Hits

Swiss-Prot: 83% identical to MTNA_PSEPF: Methylthioribose-1-phosphate isomerase (mtnA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 97% identity to pfs:PFLU1641)

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

• 5'-deoxyadenosine degradation I (1/3 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (2/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (2/5 steps found)
• 5'-deoxyadenosine degradation II (1/4 steps found)
• L-methionine salvage cycle III (5/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (2/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)
• L-methionine salvage cycle II (plants) (3/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

See A0A1N7U1C5 at UniProt or InterPro

Protein Sequence (358 amino acids)

>PS417_08110 methylthioribose-1-phosphate isomerase (Pseudomonas simiae WCS417)
MRDRLLAAEKVKAIDWRDGALYLLDQRALPSRESWVACSTVDDVAAAIRSMVVRGAPAIG
ISAAYGLVLAARERIAEGGDWQAAWEEDYALLADTRPTASNLFWALKRMRDRLDRVKKHA
DPLAVLEAEAIAIHESDREANLTMAQLGVDLIRKHQGNAQAILTHGNAGALATGGVGTAL
GVIRAAYLEGMVEQVYVNETRPWLQGSRLTAWELAGEGIPVTVNADSASAHILKTKGVTW
VIVGADCIAANGDVISKIGTYQLAVCAMHHGVRFMVVAPSSTLDMMMATGDDVALEERDA
GELLEVAGQRFAADVVAFNPVFDVTPADLIDVIVTEKGIVERPDTAKLAKLMCRKRLH