Protein Info for GFF1592 in Variovorax sp. SCN45

Annotation: Response regulator/GGDEF/EAL domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 746 PF11849: DUF3369" amino acids 142 to 310 (169 residues), 126.2 bits, see alignment E=2.5e-40 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 312 to 463 (152 residues), 64.5 bits, see alignment E=4.7e-22 PF00990: GGDEF" amino acids 315 to 462 (148 residues), 85.6 bits, see alignment E=4.9e-28 PF00563: EAL" amino acids 484 to 717 (234 residues), 229.5 bits, see alignment E=5.9e-72

Best Hits

KEGG orthology group: None (inferred from 64% identity to aav:Aave_2925)

Predicted SEED Role

"Response regulator/GGDEF/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (746 amino acids)

>GFF1592 Response regulator/GGDEF/EAL domain protein (Variovorax sp. SCN45)
MRREAEPGRSARAKGRAPDWRVLVVDQDADVHAAARAALQGLTLFERPLVFVHAYSGEEA
RALVLREHDLAVVILDVVTESTKAGLDLVDFIRHTAGLRNTRIVLRTGGPGHVPALDTLL
RYDINDYRTKAELTQDRLLAMVVTAVRSYKQLCAIEANSRSLELIVRSSASLLEETDLRA
FARSIITQLIALLGAAGDGLVCAPGMQPASPYRVVAAAGRFTGLVDLPLDALPELPELSG
LHLLRRALSLGCNVYGEDGGVALHIGRKDDQDMAVFIDTTGLRGTVDRQLLDVFCVNLST
LLHSRGLLERLHEYAYYDPLVRLPNRTHFVEKVDDCARQGMRDHILALVDIDDFSATNDV
MGHRFGDRLLETVARRLADALPAEVVLARLGADTFGVLGPVGQVSPTQLLECVRQPLAVD
GVPHKVSLTCGYVLLPEDAQAGVDLVKDATIALKRAKRDHRGQHLQYSGHMGTEARARAL
LLSNLRAAIDNAQLFLVYQPQIDLNTRALVGLEALLRWRADDGNLVPPDRFIPVAEHSGL
IVALGQWVLSTACMTMRELLDAGCAPLRMAVNVSTVQLRDPGFFETVRAALSHSRLQGSH
LELEITESVAVLPTQLLESTLTALRAEGISIAIDDFGTGYSSLSYLERLPLDRIKIDGTF
VRQLSETQGARIAEMVVQLGRKLGLHVLAEGIEDDAAWQALLAMDCNEGQGYCIAPPMDK
DSLFRWLQQRADRREGIALHSGLDGA