Protein Info for GFF1585 in Xanthobacter sp. DMC5

Annotation: 2-hydroxymuconate tautomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01361: Tautomerase
  • amino acids 2 to 60 (59 residues), 45.3 bits, E=3.2e-16

Best Hits

Swiss-Prot: 32% identical to 4OT1_PSEPU: 2-hydroxymuconate tautomerase (xylH) from Pseudomonas putida

KEGG orthology group: None (inferred from 47% identity to mpt:Mpe_A3323)

MetaCyc: 32% identical to 4-oxalocrotonate tautomerase subunit (Pseudomonas putida mt-2)
RXN-8529 [EC: 5.3.2.6]

Predicted SEED Role

No annotation

MetaCyc Pathways

• 3-chlorocatechol degradation III (meta pathway) (2/4 steps found)
• orthanilate degradation (2/5 steps found)
• protocatechuate degradation III (para-cleavage pathway) (2/5 steps found)
• catechol degradation to 2-hydroxypentadienoate II (1/4 steps found)
• 4-amino-3-hydroxybenzoate degradation (2/6 steps found)
• 2,3-dihydroxybenzoate degradation (1/5 steps found)
• catechol degradation II (meta-cleavage pathway) (2/7 steps found)
• meta cleavage pathway of aromatic compounds (4/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (4/13 steps found)
• 4-chloronitrobenzene degradation (1/9 steps found)
• 2,2'-dihydroxybiphenyl degradation (1/10 steps found)
• superpathway of aerobic toluene degradation (9/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (7/42 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.2.6

Protein Sequence (70 amino acids)

>GFF1585 2-hydroxymuconate tautomerase (Xanthobacter sp. DMC5)
MPIVNVVLLEGRTQAQKDDMYREVTDALCRTLECRPDQVRIMVQDFANADFAVAGKSVAT
IQAERAARTG