Protein Info for GFF1582 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 47 to 68 (22 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details PF02203: TarH" amino acids 37 to 203 (167 residues), 33.2 bits, see alignment E=9.6e-12 PF12729: 4HB_MCP_1" amino acids 40 to 216 (177 residues), 43.8 bits, see alignment E=4.2e-15 PF00672: HAMP" amino acids 245 to 295 (51 residues), 41.9 bits, see alignment 2.1e-14 PF00015: MCPsignal" amino acids 359 to 515 (157 residues), 184.1 bits, see alignment E=4.3e-58

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 52% identity to hse:Hsero_3032)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>GFF1582 Methyl-accepting chemotaxis protein I (serine chemoreceptor protein) (Hydrogenophaga sp. GW460-11-11-14-LB1)
LVALAGIYRSRFPGKRRYGSQGALHACFILTIESPGMFKNLHIGPRLYLGFTTVLVLLVG
ITVLAWISLKASQDAMKLVVDVQQRLAMTEDWAEHTNLNINRVMAQAVSRNDLRVREHFE
PLSAASTKEVNRLQQALEAQITNPRGQVMLAAIAERRTEYVDIRTRFFEALQREDYDGAT
GILNTALTPAAERYSAAQEELIAAMRHLMDQTVAEADSAASRMVMLLVGMAICAVALATF
VAWAITRSVTEPLKAALRATEAVAEGDLTQEVHVDRQDELGRLLSGLAHMRASLVKTVGQ
VRAATDSIHTASTEIATGNQDLSARTEQTASNLQETAASMEQLTGTVRNSADAARQANQL
ATSAAEIAQRGGSVVSQVVSTMDEINSSSRKINDIIGVIDGIAFQTNILALNAAVEAARA
GEQGRGFAVVAGEVRNLAQRSAEAAKEIKMLIGTSVDKVETGSALVANAGQTMEELVSSV
QRVTDIIGEITAAAGEQSDGIGQVNVAVSQLDQMTQQNAALVEESAAAAQSLREQATRLA
EVVQVFRLRA