Protein Info for PS417_08030 in Pseudomonas simiae WCS417

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00126: HTH_1" amino acids 7 to 63 (57 residues), 75.5 bits, see alignment E=2.5e-25 PF03466: LysR_substrate" amino acids 88 to 290 (203 residues), 99.4 bits, see alignment E=2e-32

Best Hits

Swiss-Prot: 65% identical to YDHB_ECOLI: Uncharacterized HTH-type transcriptional regulator YdhB (ydhB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU1625)

Predicted SEED Role

"LysR-family transcriptional regulator YdhB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3U6 at UniProt or InterPro

Protein Sequence (307 amino acids)

>PS417_08030 transcriptional regulator (Pseudomonas simiae WCS417)
MWSEYSLDVVDAVARHGSFSAAAQELHRVPSAVSYTVRQLEEWLAVPLFVRRHRDVELTP
AGRLFIDEARGVMKKMLGTRRLCQQVANGWSGQLKVAVDSIVKPQRCRQLVLDFYRQFPE
VELLLEYEVYNGVWDALADERTDIVIGATSAVPVASHFTFRDMGLLNWLCVVSARHPLAS
VEGLLSDDQLRPFASLCMTDTSRNLPKRDTWTLDNQRRLVVPNWASAIDCLRDGLCVGMA
PAHQVLPWIERGELVALQLSRPFPASPSCVAWAQNKLSPAMTWLLEYLGDTETLNQEWLN
GPTPVTG