Protein Info for PS417_08015 in Pseudomonas simiae WCS417

Annotation: haloacid dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF00702: Hydrolase" amino acids 3 to 184 (182 residues), 34.2 bits, see alignment E=3.6e-12 PF13419: HAD_2" amino acids 6 to 186 (181 residues), 35.6 bits, see alignment E=1.1e-12 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 118 to 189 (72 residues), 33.5 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: None (inferred from 70% identity to pfl:PFL_2156)

Predicted SEED Role

"Hydrolase (EC 3.8.1.2)" (EC 3.8.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEX0 at UniProt or InterPro

Protein Sequence (207 amino acids)

>PS417_08015 haloacid dehalogenase (Pseudomonas simiae WCS417)
MTVRAVVFDFGGVLFDWSPQHLYRTLIADDGERQWFLENICTQAWNTEQDAGRSLTEGTR
SLIEQHPHHERLIQAYYDRWHEMLRGPLTEGVAILEALHQADMPLFGLTNWSAETFPYAR
ANYPFLQFFRDIVVSGELKLIKPDAAIYDASLSQVRAHLPDIQAAEVVFIDDVAGNIEAA
IALGWRGIHHVSAERTAAQLREWGVGF