Protein Info for GFF1575 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Nudix-related transcriptional regulator NrtR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 9 to 97 (89 residues), 29.4 bits, E=7.1e-11

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 54% identity to aav:Aave_4021)

Predicted SEED Role

"Nudix-related transcriptional regulator NrtR" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (216 amino acids)

>GFF1575 Nudix-related transcriptional regulator NrtR (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTIILTVDAVLLTLVEGELEVALFKRDSEPFKGLWALPGGYVHEDKDDHAGAAAARVLKH
KAGVVSPYLEEYGTFSGPGRDPRGWSLTVVYYALVPASVLGDGVHRFKVSQLPALPFDHA
QIIASVLARVRNKAAYSSLPAFLCGEEFTVPELHAVYEAVLAQPLNLPNFRRKLDDLGIL
EEVPGATKLGGRNRPAQLYRLKKQFRSSLSVRDRGL