Protein Info for GFF1574 in Methylophilus sp. DMC18

Annotation: Sec-independent protein translocase protein TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 74 to 97 (24 residues), see Phobius details amino acids 109 to 135 (27 residues), see Phobius details amino acids 155 to 181 (27 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 8 to 224 (217 residues), 234.6 bits, see alignment E=6e-74 PF00902: TatC" amino acids 9 to 219 (211 residues), 239.1 bits, see alignment E=2.2e-75

Best Hits

Swiss-Prot: 57% identical to TATC_AZOCH: Sec-independent protein translocase protein TatC (tatC) from Azotobacter chroococcum mcd 1

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 68% identity to meh:M301_0314)

MetaCyc: 54% identical to twin arginine protein translocation system - TatC protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>GFF1574 Sec-independent protein translocase protein TatC (Methylophilus sp. DMC18)
MTPTESFISHLIELRNRLLRAVAGWLVIFVALFPFADRIYHLLAAPLLAKLPQGAQMIAT
AVTTPFFVPMKVTMMAAFLIALPWMIYQCWAFIAPGLYAHEKRLIRPMLAAAIGLFFMGM
AFAYFAVFPVVFGFLVGSAPAGVAVMTDIAEYLDFVIGMFLAFGFAFEVPIAVILLSLMG
WVTLAQLKEARSYVIVGAFVLGAIFTPPDIVSQCMLAIPLWLLYELGLLVVRWLPQLPAD
SATPT