Protein Info for GFF1568 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: gamma-aminobutyrate (GABA) permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 120 to 120 (1 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 155 to 180 (26 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details amino acids 429 to 449 (21 residues), see Phobius details TIGR01773: GABA permease" amino acids 1 to 452 (452 residues), 822.3 bits, see alignment E=5e-252 PF00324: AA_permease" amino acids 18 to 453 (436 residues), 452.2 bits, see alignment E=2.1e-139 PF13520: AA_permease_2" amino acids 19 to 428 (410 residues), 118.9 bits, see alignment E=2.7e-38

Best Hits

Swiss-Prot: 92% identical to GABP_ECOLI: GABA permease (gabP) from Escherichia coli (strain K12)

KEGG orthology group: K11735, GABA permease (inferred from 100% identity to sty:STY2913)

MetaCyc: 92% identical to 4-aminobutanoate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-384; TRANS-RXN-57

Predicted SEED Role

"gamma-aminobutyrate (GABA) permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>GFF1568 gamma-aminobutyrate (GABA) permease (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MGQLSESHALGGGLKSRHVTMLSIAGVIGASLFVGSSVAIAEAGPAVLLAYLFAGLLVVM
IMRMLAEMAVATPDTGSFSTYADKAIGPWAGYTIGWLYWWFWVLVIPLEANIAAIILNSW
IPGIPVWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIALGATAISGFYPY
AEVSGISRLWDHGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPDKHIVRATNS
VIWRISIFYLCSIFVVVALIPWNMPGLKSVGSYRSVLELLHIPHAKFIMDCVILLSVTSC
LNSALYTASRMLYSLSRRGDAPAIMGKTNRSKTPWVAVLLSTGAAFLTVIVNYYAPAKVF
KFLIDSSGAIALLVYLVIAISQLRMRKILLAQGGEIKLKMWLYPWLTWLVIGFICFVLVV
MLFRPAQQLEVISTGLLGLGIIGTVPIMSRWKKLIRWQKAPLQNLR