Protein Info for PS417_07950 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 371 to 388 (18 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 354 (331 residues), 158.7 bits, see alignment E=2e-50 PF06779: MFS_4" amino acids 28 to 384 (357 residues), 31.9 bits, see alignment E=9.2e-12

Best Hits

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 97% identity to pfs:PFLU1602)

Predicted SEED Role

"MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVW7 at UniProt or InterPro

Protein Sequence (395 amino acids)

>PS417_07950 MFS transporter (Pseudomonas simiae WCS417)
MTIQQTPGHVLPARSAAKMEAAMAVGAFAIGTGEFAIMGLMPDIAQNLGLSEPQVGHAIS
AYALGVMVGAPLLAILGAKLLRKHMLLLLMGLYALGNLATAFTPTFGSLVAFRFISGLPH
GAYFGIAAVVASSMVPNDKRAGAVARVMMGLTLAMLLGNPIATFLGQHLGWRSAFALVSV
IALCTIALVWQYVPHRHDEQRSDPRKEMRAFTKPQVWMALSIGAIGFAGMFCVFSYLAPT
MLEVTKVSPQWIPFGLAAFGVGGIIGNIAGGKLFDRMQFRAVGLILVWSMAVLLFFPFAV
SSLWGVLLSMGLVGTMVALAAPLQIRLMDIAHEAPSLAAASNHAAFNLANALGPWFGGMA
ITAGYGWTSTGYIGAATALVGLGIYLIARRMKGGH