Protein Info for GFF156 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: rRNA small subunit methyltransferase H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00006: 16S rRNA (cytosine(1402)-N(4))-methyltransferase
  • amino acids 1 to 310 (310 residues), 444.7 bits, E=1e-137
• PF01795: Methyltransf_5
  • amino acids 4 to 310 (307 residues), 407.8 bits, E=1.8e-126

Best Hits

Swiss-Prot: 100% identical to RSMH_SALTY: Ribosomal RNA small subunit methyltransferase H (rsmH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03438, S-adenosyl-methyltransferase [EC: 2.1.1.-] (inferred from 99% identity to sec:SC0117)

MetaCyc: 96% identical to 16S rRNA m4C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11638 [EC: 2.1.1.199]

Predicted SEED Role

"rRNA small subunit methyltransferase H" in subsystem Bacterial Cell Division

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.199

Protein Sequence (313 amino acids)

>GFF156 rRNA small subunit methyltransferase H (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMENFKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQLGEEGRLLAIDRDPQA
IAVAQTINDPRFSIIHGPFSALADYVAERELTGKIDGILLDLGVSSPQLDDAERGFSFMR
DGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTFGEERFAKRIARAIVERNREQPMTRT
KELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQALKSSLSVLAPGGRLSIIS
FHSLEDRIVKRFMREQSRGPQVPAGLPMTEAQLKKLGGRELRALGKLMPGEKEVAENPRA
RSSVLRIAERTNA