Protein Info for GFF1553 in Pseudomonas sp. DMC3

Annotation: Sensor histidine kinase RcsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 743 PF13185: GAF_2" amino acids 172 to 313 (142 residues), 36 bits, see alignment E=1.9e-12 PF01590: GAF" amino acids 173 to 311 (139 residues), 50.6 bits, see alignment E=7.5e-17 PF00512: HisKA" amino acids 363 to 425 (63 residues), 34.9 bits, see alignment E=3.3e-12 PF02518: HATPase_c" amino acids 471 to 587 (117 residues), 60.9 bits, see alignment E=4e-20 PF00072: Response_reg" amino acids 613 to 717 (105 residues), 63.9 bits, see alignment E=3.6e-21

Best Hits

KEGG orthology group: None (inferred from 75% identity to pba:PSEBR_a3973)

Predicted SEED Role

"Sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (743 amino acids)

>GFF1553 Sensor histidine kinase RcsC (Pseudomonas sp. DMC3)
MTDWLQDNGEMAGQIRRHDWANSPLGPLENWPDVLKTTVSLSLASHFPQAIVWGPQLITL
YNDAFVPILGDKPHALGRPFSDIWKEAWHEISPIAEAAYAGQATYIENFALQIERGKGPE
QAFFTFCYSPIRDSHGNVVGMIDTVTETTQTVYLNRRLAVLDAIGEAVTNATDAQAILAA
STRLMVEQLRLSNCAYADMDADEDGFTIRGDYAAPGSPSIVGHYHLRDFGEKAVRLLRAG
QPLVIHDNRSELPPEESATFQGIGITATICVPLIKQGRLTALMAIHDKVPRVWSSFEQAL
LSEVTERCWAHIERVRADANVREGLLALAELNATLEQRVEERSLRLAQAESALRQSQKLE
AIGQLTGGVAHDFNNLLTIIRSSVDFLRQPNLPEERRQRYMRAVSDTVERASKLTSQLLA
FARRQPLNPQVVDAGERLANIGEMLESVTGAQIHVCVERPDHPCYIRVDLSQFETALINI
ALNARDAMNGQGELKLRLECHKALPPIRGHAGSSSHFVSIALADTGAGIDAHTLEHIFEP
FFTTKAVGKGTGLGLSQVFGFAKQSGGNVDVSSVLGQGTEFTLYLPQVPAIEAEMDEAEE
NGEVQPACEKRRVLVVEDNLDVGRFANQILQDLGYETAWATNAEEALQLAGSDASAFDAV
FSDVVMPGITGVALAKELRQRRPDLPVILTSGYSEELARSGYEGFEFLAKPYSAEQVSRI
LGKTWLKDAKPAASVVIDAGALE