Protein Info for GFF155 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 55 to 81 (27 residues), see Phobius details amino acids 101 to 131 (31 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 224 to 247 (24 residues), see Phobius details PF01061: ABC2_membrane" amino acids 8 to 218 (211 residues), 111.8 bits, see alignment E=1.7e-36

Best Hits

Swiss-Prot: 40% identical to YADH_ECOL6: Inner membrane transport permease YadH (yadH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 81% identity to mmt:Metme_3595)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF155 ABC-type multidrug transport system, permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSLNIHGIKAIYRFEMARTFRTITQSILAPVLTTSLYFIVFGTAIGSRMGDIDGVTYGAF
IIPGLVMLSLLSESISNASFGIYMPKWSGTIYELLSAPVSWIEVLLGYVGAAATKSVMLG
LLILLTARVFVPYHIAHPVWMLGFLLLTAVTFSLFGFIIGLWADNFQKLQVIPLLVVTPL
TFLGGAFYSINMLPPLWQTVSLVNPVVYLISGFRWAFYGVADVHIAVSTGMTLVFMALCL
GFIWWVFRTGYKLRR