Protein Info for GFF1546 in Variovorax sp. SCN45

Annotation: Tripartite tricarboxylate transporter TctA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 83 to 96 (14 residues), see Phobius details amino acids 107 to 134 (28 residues), see Phobius details amino acids 139 to 182 (44 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details amino acids 384 to 404 (21 residues), see Phobius details amino acids 414 to 442 (29 residues), see Phobius details amino acids 463 to 488 (26 residues), see Phobius details PF01970: TctA" amino acids 20 to 436 (417 residues), 470.4 bits, see alignment E=2.4e-145

Best Hits

KEGG orthology group: None (inferred from 95% identity to vap:Vapar_6020)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>GFF1546 Tripartite tricarboxylate transporter TctA family (Variovorax sp. SCN45)
VEVLNNLAFGFSHALTWQNLMFCAIGCSVGTLVGLLPGLGPLATISLLLPLTYSIPTTGA
LIMLAGIYYGAQYGDSVSAITMKIPHASSIVACIDGYAMTLKGQTGLALFTAGFSSFIGG
TVAILVLTFLAPVLGEVAFLFGPADYVAMMLVGFVCVSFVTTGSLLNGLAMCMIGVLLGT
IGTDVNSGMQRFTMDLPFLVDGVGIVSIALGCFGIAEITKNLDSKEERSPFNGKINLIPT
REEFMRIIPSALRGSVIGSFLGILPGGGPTIAQFAAYAIDKKVSKYKHEIGSGCIEGVAG
QAAADEAAARTSFIPLMSIGIPENAVMALMLAAFIIKGIQPGPNMIASHPDLFWGLVASM
WIGNVFLLVLNVPLVRYWLSVFKIPYAVLFPSILFFCCIGTYSVNNNLEDVFITAAFGFM
GYMFMRLELDAAPLMLGFILGPMLEENFRRAMLLSRGSFGTFVNRPISGTLLSLIAIFVA
WQVVSFFFQARKRVAIEAK