Protein Info for GFF1540 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 215 to 232 (18 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 6 to 273 (268 residues), 116.6 bits, see alignment E=5.9e-38

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 39% identity to mes:Meso_0478)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>GFF1540 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVISLIVAGLALGSIYALLGLSLVLVNKATDVVNFAQGEIGMIGAFTGMTVLAASGWPLP
LVFVVGMLSGALLGMFLERVVIRPLGAAPHLNLLIVTVGLWFIFNSVAGLIWGYDPYRFP
SLLPAEPLDLFGAKVPPSSLGIVAVACVAMVLLYLFFEHTRDGIAMRAASNNPRAARLMG
IRVERVAAISWAVACGLSVTSAMLIAPVTFLDQQMMVPVILKAFAGAILGGFTSLPGTVV
GCVLLGLAETFVGAYLSAALKDALAFTLIILVLMVKPAGLFGRSIRKKV