Protein Info for GFF1531 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Tagatose 1,6-bisphosphate aldolase (EC 4.1.2.40)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00167: ketose-bisphosphate aldolase
  • amino acids 1 to 283 (283 residues), 357.2 bits, E=6.7e-111
• TIGR01858: class II aldolase, tagatose bisphosphate family
  • amino acids 3 to 283 (281 residues), 514.7 bits, E=5.2e-159
• PF01116: F_bP_aldolase
  • amino acids 5 to 283 (279 residues), 351.4 bits, E=2.1e-109

Best Hits

Swiss-Prot: 100% identical to GATY_SALTI: D-tagatose-1,6-bisphosphate aldolase subunit GatY (gatY) from Salmonella typhi

KEGG orthology group: K08302, tagatose 1,6-diphosphate aldolase [EC: 4.1.2.40] (inferred from 100% identity to spt:SPA3122)

MetaCyc: 65% identical to tagatose-1,6-bisphosphate aldolase 2 (Escherichia coli K-12 substr. MG1655)
Tagatose-bisphosphate aldolase. [EC: 4.1.2.40]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of hexitol degradation (bacteria) (18/18 steps found)
• galactitol degradation (5/5 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (3/4 steps found)
• D-tagatose degradation (2/3 steps found)
• N-acetyl-D-galactosamine degradation (3/5 steps found)
• lactose degradation I (2/5 steps found)

KEGG Metabolic Maps

• Galactose metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.40

Use Curated BLAST to search for 4.1.2.40

Protein Sequence (284 amino acids)

>GFF1531 Tagatose 1,6-bisphosphate aldolase (EC 4.1.2.40) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFIISSKNMLQKAQHAGYAVPAFNIHNLETLQVVVETAAEMRSPLIVAGTPGTFSYAGMG
NIVAIAGDLAREYNLPLAIHLDHHESLADIESKVMAGIRSVMIDGSHFPFEENVALVKSV
VDFCHRYDTSVEAELGRLGGIEDDLVVDSKDALYTNPQQAREFVARTGIDSLAVAIGTAH
GMYAAEPKLDFERLAEIRALVDIPLVLHGASGLPESDIRQAISLGVCKVNVATELKIAFS
DALKEYFLQNPKANDPRHYMQPAKQAMKEVVRKVIHVCGCEGQL