Protein Info for GFF153 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF13432: TPR_16" amino acids 18 to 81 (64 residues), 36 bits, see alignment E=3.5e-12 PF14559: TPR_19" amino acids 25 to 88 (64 residues), 33.2 bits, see alignment E=2.4e-11 PF07719: TPR_2" amino acids 48 to 80 (33 residues), 24 bits, see alignment 1.3e-08 PF13489: Methyltransf_23" amino acids 149 to 251 (103 residues), 28.9 bits, see alignment E=4.1e-10 PF13847: Methyltransf_31" amino acids 155 to 252 (98 residues), 30.8 bits, see alignment E=1.1e-10 PF08242: Methyltransf_12" amino acids 156 to 247 (92 residues), 40.5 bits, see alignment E=1.8e-13 PF13649: Methyltransf_25" amino acids 156 to 245 (90 residues), 40.4 bits, see alignment E=1.8e-13 PF08241: Methyltransf_11" amino acids 156 to 249 (94 residues), 38.2 bits, see alignment E=8.2e-13

Best Hits

KEGG orthology group: None (inferred from 74% identity to xau:Xaut_1472)

Predicted SEED Role

"Methyltransferase type 11"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>GFF153 hypothetical protein (Xanthobacter sp. DMC5)
LSAAAFDTSGDPVLDRRLDWARAFLAEGDFAAAAELLAETVEAAPGFAAAWFLLGEAREG
QGEGEAAREAYGRALALDPADRLGAGLRRARLGGAEGAGEGVMSAAYVRTLFDQYADRFD
TALREKLAYRGPELLLEAVRAACDTLGRELRFGAALDLGCGTGLAGVLFAPLVERLDGVD
LSPAMLEKARALGLYAALEAGEMGAALGAMSAGGLDLVIAADALCYVGDLAPIFHAARAA
LASGGLFAFTLETHEGEGVLLRETLRYAHAEAYVRVLAQDVGLDVVLLERASTRSEKSVP
VPGLVGVLVAG