Protein Info for GFF153 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 194 to 219 (26 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 275 (184 residues), 96.3 bits, see alignment E=9.5e-32

Best Hits

Swiss-Prot: 36% identical to DPPC_BACPE: Dipeptide transport system permease protein DppC (dppC) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 95% identity to vap:Vapar_5949)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>GFF153 ABC transporter, permease protein 2 (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MTTMKRKKRIPLNALIGIVIVGLIVAAALVSLVWTPHDPLRINFGARLKLPGGAFLLGTD
EFGRDELSRLMAGAATSVWIAVLTVGFSIVVGSIVGVLTGFLRGWTDRIVMAFNNALLAF
PGLLLALGLLAVVGANQYGIVLALGLAYTPSVTRIVRGTVLSLREKEFIESSRVLGNSEL
YTMVRHVLPNCTAPLTVLATSMFGWVILAESALSFLGLGVPPPAPTWGNMLASARPFMAQ
ASYLSILPGLCIALTLLGINLLGDAVRDWLDPRMKGVQ