Protein Info for GFF1528 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, tagatose-specific IIA-TPr component (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF00359: PTS_EIIA_2" amino acids 5 to 139 (135 residues), 104.2 bits, see alignment E=6.2e-34 TIGR01003: phosphocarrier, HPr family" amino acids 156 to 237 (82 residues), 71 bits, see alignment E=3.2e-24 PF00381: PTS-HPr" amino acids 156 to 238 (83 residues), 89.4 bits, see alignment E=1.3e-29

Best Hits

KEGG orthology group: K11189, phosphocarrier protein (inferred from 99% identity to stt:t3176)

Predicted SEED Role

"PTS system, tagatose-specific IIA-TPr component (EC 2.7.1.69)" in subsystem D-Tagatose and Galactitol Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>GFF1528 PTS system, tagatose-specific IIA-TPr component (EC 2.7.1.69) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQLCEHDIFISDERLDKVTALHRVVEKLSAAGNTTTDYLRGMLDREAQISTYLGNGIAIP
HGTPESRDAVLQTGVKVIVFRHGVDWGDGNTAYLVTGIAARSNEHLEILRQLTRVLSDDA
ILQALAKAESPSQVLALLTGSTTNTPAAVELQEGEQATFVIHNPHGLHARPSAVLVKFIK
QFQSHITVENLDNASGPVDGKNLMRVVSLGAKKGHRLLFRAQGEDAQQALREIGELIASG
AGEMITVPVTPPPEVMQPKRSWLSRLFN