Protein Info for GFF1524 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, galactitol-specific IIC component (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details PF03611: EIIC-GAT" amino acids 8 to 386 (379 residues), 310.5 bits, see alignment E=9.3e-97 TIGR00827: PTS system, galactitol-specific IIC component" amino acids 9 to 412 (404 residues), 666.6 bits, see alignment E=6.6e-205

Best Hits

Swiss-Prot: 86% identical to PTKC_ECOLI: PTS system galactitol-specific EIIC component (gatC) from Escherichia coli (strain K12)

KEGG orthology group: K02775, PTS system, galactitol-specific IIC component (inferred from 99% identity to stt:t3180)

MetaCyc: 86% identical to galactitol-specific PTS enzyme IIC component (Escherichia coli EC3132)
TRANS-RXN-161 [EC: 2.7.1.200]; TRANS-RXN-169 [EC: 2.7.1.200, 2.7.1.198]

Predicted SEED Role

"PTS system, galactitol-specific IIC component (EC 2.7.1.69)" in subsystem D-Tagatose and Galactitol Utilization (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.198 or 2.7.1.200 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>GFF1524 PTS system, galactitol-specific IIC component (EC 2.7.1.69) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFSEIMRYILDLGPTVMLPLVIIVFSKLLGMKLGDCFKSGLHIGIGFVGIGLVIGLMLDS
IGPAAKAMAEHFQINLHVIDVGWPGSSPMTWASQIALVAIPVAIGVNVLMLVTRMTRVVN
VDIWNIWHMTFTGAMLHLATGSYWLGILGVVVHAAFVYKLGDWFAKDTRDYFGLEGIAIP
HGSSAYLGPVAVLVDTIIEKIPGLNRIHFSADDVQKRFGPFGEPVTVGFVMGLVIGVLAG
YDAKAVLQLAVKTAAVMLLMPRVIKPIMDGLTPIAKHARKRLQAKFGGQEFLIGLDPALL
LGHTSVVSASLIFIPLTILIAVLVPGNQVLPFGDLATIGFFIAMAVAVHQGNLFRTLISG
VIIMGITLWIATQTIGLHTQLAANAGALKAGGQVASLDQGGSPITWLLIQLFTWQNIVGF
AVIAIIYLAGVLLTWRRARQFVAAEKATALQQSQIAS