Protein Info for GFF1523 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF08240: ADH_N" amino acids 25 to 132 (108 residues), 91.8 bits, see alignment E=6.2e-30 PF16912: Glu_dehyd_C" amino acids 140 to 331 (192 residues), 42.9 bits, see alignment E=8.1e-15 PF01262: AlaDh_PNT_C" amino acids 158 to 226 (69 residues), 31.4 bits, see alignment E=2.7e-11 PF00107: ADH_zinc_N" amino acids 172 to 307 (136 residues), 86.4 bits, see alignment E=3.3e-28

Best Hits

Swiss-Prot: 69% identical to GATD_ECOLI: Galactitol 1-phosphate 5-dehydrogenase (gatD) from Escherichia coli (strain K12)

KEGG orthology group: K00094, galactitol-1-phosphate 5-dehydrogenase [EC: 1.1.1.251] (inferred from 99% identity to seh:SeHA_C3556)

MetaCyc: 69% identical to galactitol-1-phosphate 5-dehydrogenase (Escherichia coli K-12 substr. MG1655)
Galactitol-1-phosphate 5-dehydrogenase. [EC: 1.1.1.251]

Predicted SEED Role

"Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251)" in subsystem D-Tagatose and Galactitol Utilization (EC 1.1.1.251)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.251

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>GFF1523 Galactitol-1-phosphate 5-dehydrogenase (EC 1.1.1.251) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKSVVIHAEGDVRVEERPLPQLQAEDDVLVKVVSSGLCGSDIPRIFAQGAHYYPITLGHE
FSGYVESYGTGVTDMQPGDAVACVPLLPCFHCPQCERGYFSLCKQYQFVGSRSEGGNAEY
VVVKRANLFRLPSDMPIEDGAFIEPITVGLHAFHLAQGCEGKNVIIVGAGTIGLLALQCA
RELGARSVTAIDINPQKLELAKALGATHTCNSREMTADDIQTALSDIQFDQLVLETAGTP
QTVSLAIDIAGPRAQLALVGTLHHDLTLTTRTFGLILRKELTLLGSWMNYSAPWPGEEWE
TAARLLAEKRLQLTPLIAHRGDAESFAEAVKALNGAPMQGKILLQLS