Protein Info for GFF1519 in Variovorax sp. SCN45

Annotation: TRAP-type C4-dicarboxylate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03480: DctP" amino acids 30 to 313 (284 residues), 302 bits, see alignment E=2.2e-94 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 30 to 284 (255 residues), 258.9 bits, see alignment E=2.5e-81

Best Hits

Swiss-Prot: 38% identical to Y1028_HAEIN: Uncharacterized protein HI_1028 (HI_1028) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 91% identity to vpe:Varpa_0718)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF1519 TRAP-type C4-dicarboxylate transport system, periplasmic component (Variovorax sp. SCN45)
VKLLRTLAVAGLCIGLVAPTWAQQERVIRFGHLNNADHPVSFGVKRFAELLAAKSGGKMK
VQEYPASQLGNEMQQQSALQGGVQQMSAPATTSLAGIVKEFGLVDFPFSVNNFAQADALL
DGPLGQALIAKLPEKGLVALGYWDLGFRNVTNSKRPIAKPEDLEGLKIRVIPNPVFLETF
KSFKANPVPMPFAELYGALESKAVDGQENPYSVILSNKFFEVQKFVSATNHVYAANIVLV
SKKFWDSLSAAEQKMMNEAADEARGYQRQVSRAAAQKAIGDLQAKGAQFNEVSAAEQVRM
REIAKPAIDKFASQYDAGIVKLYNDELARIRKQ