Protein Info for GFF1513 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG137864: putative endonuclease containing a URI domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details PF01541: GIY-YIG" amino acids 24 to 96 (73 residues), 56.5 bits, see alignment E=1.4e-19

Best Hits

Swiss-Prot: 100% identical to YHBQ_SALTI: UPF0213 protein YhbQ (yhbQ) from Salmonella typhi

KEGG orthology group: K07461, putative endonuclease (inferred from 98% identity to ses:SARI_04352)

MetaCyc: 81% identical to DNA damage response nuclease YhbQ (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"FIG137864: putative endonuclease containing a URI domain" in subsystem CBSS-214092.1.peg.3450

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.1

Use Curated BLAST to search for 3.1.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (120 amino acids)

>GFF1513 FIG137864: putative endonuclease containing a URI domain (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VSIFILAYTGNLKIIMLMATMTPWYLYLIRTADNALYTGITTDVARRYRQHQTGKGAKAL
RGKGELTLAFAAQVGDRSLALRIEYRIKQLTKRQKERLVTEREAFEALLSSLQTPVLKND