Protein Info for PS417_00760 in Pseudomonas simiae WCS417

Annotation: ShlB family hemolysin secretion/activation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF08479: POTRA_2" amino acids 77 to 152 (76 residues), 82 bits, see alignment E=3.3e-27 PF17287: POTRA_3" amino acids 153 to 208 (56 residues), 65 bits, see alignment 5.2e-22 PF03865: ShlB" amino acids 213 to 525 (313 residues), 311.3 bits, see alignment E=1.3e-96

Best Hits

KEGG orthology group: None (inferred from 86% identity to pfs:PFLU0147)

Predicted SEED Role

"Channel-forming transporter/cytolysins activator of TpsB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TWT0 at UniProt or InterPro

Protein Sequence (573 amino acids)

>PS417_00760 ShlB family hemolysin secretion/activation protein (Pseudomonas simiae WCS417)
MSLLLPRTRLLLCTFMLAYLGLNSATAAPTPGDQDLIRDRQNRLLEEQRRRLEELKDLPG
KEARPTAPATPADTRCFPIRDIELKGADSLSADDRAGLLKPYTGQCLGVSQLNELLKVIT
DFYLSKGRVTSRAYLPQQDLSSGHLQVLVVEGKLEALKSAPGSTVTDRELAMAFPGKVGE
ALNLREVEQLVDQLNRLPSKQAQMELTPGTQIGGSEVVVKNTPQKPWRASLSRNNDGQKS
TGEQQWGAGLEWDSPLGLADHLVLRGGHDAVSDHQKTSKNSMLYYNVPWGWWNFSYTYSE
SDYRTYGMLNDFKFKQNGDNQNHQLRAERVVHRDDVSKTSVNVGLAHLRTNNYILDTRTS
TSSNRLSELQLGINHGRRIGNAFVNVDLGMQNGIGMFDAQSQEERDPFGNRQPNSRYRKY
TATVSYLQPFALWGESFSFSSLATGQRSEDILFSPQRMSLGGSASVRGFKDQQLIGDSGG
YWRNEVRWARAVTVDWLRPAFAEYGASVGYDQGVISNDRYNDRVHGRVSSNSLELFARGK
NLSTSVTFAHSLERPAVMSEREAPIYFRMDFFL