Protein Info for GFF1509 in Sphingobium sp. HT1-2

Annotation: Lipopolysaccharide biosynthesis chain length determinant protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details amino acids 480 to 501 (22 residues), see Phobius details PF02706: Wzz" amino acids 8 to 91 (84 residues), 31 bits, see alignment E=1.3e-11 TIGR03007: polysaccharide chain length determinant protein, PEP-CTERM locus subfamily" amino acids 8 to 499 (492 residues), 320.8 bits, see alignment E=5.7e-100

Best Hits

KEGG orthology group: None (inferred from 76% identity to sch:Sphch_1237)

Predicted SEED Role

"Lipopolysaccharide biosynthesis chain length determinant protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (506 amino acids)

>GFF1509 Lipopolysaccharide biosynthesis chain length determinant protein (Sphingobium sp. HT1-2)
MAGLYDELLVLLHGIWSRRWIALAVAWGVCMLGWLGVSLIPNGYESKARVYVNTQSLLED
KIGITQVQSQQDLDRVRQTLLSAENLEKVVRGTDLAQTISGPRDVAGKITTLREHITVLA
QADPSMIDISATSADSGLSDGANARIAQQVVQKLIDIFQEENLTGGRTETRQSLAFLDQQ
IAGRGKQLEAADKRRVEFAQRYAGVLPGAGTISQRMDAARLEINNIDAQLVQAQSALSAM
NGQLAGTPATLPGVAVGGGASPLAQAQAELAAMRARGWTASHPDVIAAQRQVDNLRRQGG
ASGAAAAGTPNPAYLSIKSMQAERAATVQALSTRKAQLQADLNTMTAHQIDEPGVASEQE
KLDRDYAALQTQYDKLLADREEIRLRGDVKTETGAVQFSVLQPASLPTAPAAPNRPLLLL
GVLILGIGAGIGVAFAIGQLKGTFPTAARLERAVGIPVAGSITQVASTAQVALDKQRMKW
FAGASGGLAALCLLLIVVEFIQRGTA