Protein Info for GFF1507 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 688 PF00005: ABC_tran" amino acids 34 to 192 (159 residues), 99.8 bits, see alignment E=2e-32 amino acids 399 to 548 (150 residues), 102.8 bits, see alignment E=2.4e-33 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 241 to 329 (89 residues), 86.2 bits, see alignment E=1.9e-28 amino acids 598 to 684 (87 residues), 92.5 bits, see alignment E=2.1e-30 PF08352: oligo_HPY" amino acids 243 to 307 (65 residues), 74.8 bits, see alignment E=5.8e-25 amino acids 600 to 664 (65 residues), 70.9 bits, see alignment E=9.6e-24

Best Hits

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (688 amino acids)

>GFF1507 ABC transporter, ATP-binding protein (cluster 5, nickel/peptides/opines) (Variovorax sp. SCN45)
MSAVPVQDLEVPTLEVRNLQTRFHTRAGVLPVVDGVSFTLGRGKVLGLVGESGSGKSVTG
FSIMGLVDPPGKVEGGQVLFQGRELTQLPAIERRELRGNRIAMIFQDPMATLNPVLRVDT
QMIEAVKAHKRVSTEEARRHARDTLGLMGIPSPEERLRAYPHQLSGGMRQRVAIAIAMLH
GPDLIIADEPTTALDVTIQAQILSEVQKLVRETGTSLIWISHDLSVVASLADEIAVMYAG
RIVEHGTVADVLDHPQHPYTRGLIDSLPSANERGARLRQIQGMTPSLLKMPAGCAFAPRC
PHADAACEQQRPEVSRPRHDAPWHEVRCFHPQRDKPVPAVPAAPPAAARVAAQEQDVPLI
ELRQVAQRFGATLPPGAVGRALRSVGLSKPPVVTHAVDVVDLSVRPGEVVGLVGESGCGK
STLGRIAAGLLTPTEGEVIVGGKPVASLSAQEQLAARLRIQMVFQDPYASLNPRLRVSRI
VGEAAMLHGLTDAAGQDDYVCAQLERAGLDPALRHRYPHQFSGGQRQRIGIARALAVQPS
MLVCDEAVAALDVSIQAQILNLFMDLRDQLGLAYLFISHDLGVIEHLCDRVVVMYLGRVV
ESAPVADLFARPAHPYTQALLAEIPSIDARGTTFSAIRGEIPSPIAPPSGCHFHPRCPQA
MPRCRTEVPRLRGIAIRHATACHLYDTN