Protein Info for GFF1504 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cardiolipin synthetase (EC 2.7.8.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 75 to 456 (382 residues), 302.4 bits, see alignment E=3.4e-94 PF13091: PLDc_2" amino acids 97 to 205 (109 residues), 48 bits, see alignment E=1.1e-16 amino acids 301 to 428 (128 residues), 106.1 bits, see alignment E=1.2e-34 PF00614: PLDc" amino acids 184 to 208 (25 residues), 27 bits, see alignment (E = 3.2e-10)

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 57% identity to meh:M301_0983)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>GFF1504 Cardiolipin synthetase (EC 2.7.8.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
LTASLLLAVGLVGCKSLPRVVPDLDRRPPPVRLEGSQGPLSAERSRAILERLRAGGQGSD
VLSRHLALEEAIVGSPLTAGNKVDLLEDGPATYKAMLAAIDTAKDHIHLETYILDDDEVG
QQFADALIAKQQQGVQVRLIHDSVGTLGTPKEFFKRLTDAGIQVVEFNPVNPAQARKEWE
LNERDHRKLLVVDGRIAFLGGINISGVYASGSLSMGSSSSGKTSEKKSDIDGIPWRDTHV
QLQGPVVAEFQKLFLETWAAQKGPTMAASNHYPAPVRAGSDVVRAIGSSPKDSYSLIYAT
LLSAIASAETTVYLTNAYFAPDPQLLEALEGAARRGVDVKLILPGKTDSWLIFHAGRNYY
TQLLKAGVKIYERQGVILHTKTGSVDGVWSTIGSTNLDWRSFLHNHELNAVVLGAEFSGQ
LHKLFDADLAGSKQVTLEEWQRRGLNLRFKEFFARMWEYWL