Protein Info for GFF1499 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ribosome-binding factor A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR00082: ribosome-binding factor A" amino acids 1 to 119 (119 residues), 151.1 bits, see alignment E=8.7e-49 PF02033: RBFA" amino acids 7 to 112 (106 residues), 123.7 bits, see alignment E=1.9e-40

Best Hits

Swiss-Prot: 100% identical to RBFA_SALG2: Ribosome-binding factor A (rbfA) from Salmonella gallinarum (strain 287/91 / NCTC 13346)

KEGG orthology group: K02834, ribosome-binding factor A (inferred from 98% identity to ecr:ECIAI1_3317)

Predicted SEED Role

"Ribosome-binding factor A" in subsystem NusA-TFII Cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>GFF1499 Ribosome-binding factor A (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAKEFGRPQRVAQEMQKEIAIILQREIKDPRLGMMTTVSGVEMSRDLAYAKVFVTFLNDK
DEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTNVVKHD
EERRVNPDDSKED