Protein Info for GFF1498 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Translation initiation factor 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 892 PF04760: IF2_N" amino acids 1 to 52 (52 residues), 35.7 bits, see alignment 2.3e-12 amino acids 316 to 366 (51 residues), 61 bits, see alignment 2.9e-20 PF08364: IF2_assoc" amino acids 57 to 95 (39 residues), 62.9 bits, see alignment (E = 9.7e-21) TIGR00487: translation initiation factor IF-2" amino acids 308 to 891 (584 residues), 986.8 bits, see alignment E=4.2e-301 TIGR00231: small GTP-binding protein domain" amino acids 395 to 550 (156 residues), 115.2 bits, see alignment E=2.5e-37 PF00009: GTP_EFTU" amino acids 395 to 551 (157 residues), 129.1 bits, see alignment E=6.3e-41 PF01926: MMR_HSR1" amino acids 396 to 501 (106 residues), 40 bits, see alignment E=1.6e-13 PF00071: Ras" amino acids 397 to 552 (156 residues), 22.9 bits, see alignment E=2.2e-08 PF11987: IF-2" amino acids 667 to 781 (115 residues), 146.1 bits, see alignment E=1.7e-46 PF03144: GTP_EFTU_D2" amino acids 812 to 879 (68 residues), 38 bits, see alignment 7.4e-13

Best Hits

Swiss-Prot: 94% identical to IF2_CITK8: Translation initiation factor IF-2 (infB) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 94% identity to enc:ECL_04550)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (892 amino acids)

>GFF1498 Translation initiation factor 2 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTDVTLKALAAERQVSVDRLVQQFADAGIRKSADDSVSAQEKQTLLAHLNREAVSGPDKL
TLQRKTRSTLNIPGTGGKSKSVQIEVRKKRTFVKRDPQEAERLAAEEQAQREAEEQARRE
AEEQAKREAQQKAEREAAEQAKREAAEKAKREAAEKDKVSNQQTDDMTKTAQAEKARREN
EAAELKRKAEEEARRKLEEEARRVAEEARRMAEENKWTATPEPVEDTSDYHVTTSQHARQ
AEDENDREVEGGRGRGRNAKAARPAKKGKHAESKADREEARAAVRGGKGGKRKGSSLQQG
FQKPAQAVNRDVVIGETITVGELANKMAVKGSQVIKAMMKLGAMATINQVIDQETAQLVA
EEMGHKVILRRENELEEAVMSDRDTGAAAEPRAPVVTIMGHVDHGKTSLLDYIRSTKVAS
GEAGGITQHIGAYHVETDNGMITFLDTPGHAAFTSMRARGAQATDIVVLVVAADDGVMPQ
TIEAIQHAKAAGVPVVVAVNKIDKPEADPDRVKNELSQYGILPEEWGGESQFVHVSAKAG
TGIDELLDAILLQAEVLELKAVRKGMASGAVIESFLDKGRGPVATVLVREGTLHKGDIVL
CGFEYGRVRAMRNELGQEVLEAGPSIPVEILGLSGVPAAGDEVTVVRDEKKAREVALYRQ
GKFREVKLARQQKSKLENMFANMTEGEVHEVNIVLKADVQGSVEAISDSLLKLSTDEVKV
KIIGSGVGGITETDATLAAASNAILVGFNVRADASARKVIESESLDLRYYSVIYNLIDEV
KAAMSGMLSPELKQQIIGLAEVRDVFKSPKFGAIAGCMVTEGTIKRHNPIRVLRDNVVIY
EGELESLRRFKDDVNEVRNGMECGIGVKNYNDVRVGDMIEVFEIIEIQRTIA