Protein Info for GFF1496 in Variovorax sp. SCN45

Annotation: Demethylmenaquinone methyltransferase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 30% identical to GALC_PSEPK: 4-carboxy-4-hydroxy-2-oxoadipic acid aldolase (galC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 89% identity to vap:Vapar_5585)

MetaCyc: 30% identical to subunit of 4-hydroxy-4-methyl-2-oxoglutarate aldolase (Pseudomonas putida)
4-hydroxy-4-methyl-2-oxoglutarate aldolase. [EC: 4.1.3.17]; 4.1.3.17 [EC: 4.1.3.17]

Predicted SEED Role

"Demethylmenaquinone methyltransferase"

MetaCyc Pathways

protocatechuate degradation I (meta-cleavage pathway) (7/8 steps found)
gallate degradation I (4/4 steps found)
superpathway of vanillin and vanillate degradation (8/10 steps found)
methylgallate degradation (5/6 steps found)
gallate degradation II (4/5 steps found)
4-hydroxy-4-methyl-L-glutamate biosynthesis (1/2 steps found)
syringate degradation (7/12 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.17

Use Curated BLAST to search for 4.1.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>GFF1496 Demethylmenaquinone methyltransferase-like protein (Variovorax sp. SCN45)
MSSNLPDIIRDFERVPARIVAQAAEFQPAILADVAGRRGALDGRIKALRPRMKLAGTAIT
VEVRPGDNLMIHAAIAMAQPGDVLVIDGKGDQTSALMGTIMMTACKKLGIAGVVMDGACR
DSLEIDEMDFPVFSVGTNPNGPTKNIGGRIGHPVSIGGVTVRSGDFVIGDGDGVVVVERE
KIESLLPLAARKVRDEAARIAAIKEGDTAAKWLDTALRAAGVLKEGETL