Protein Info for GFF1496 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG000325: clustered with transcription termination protein NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF02576: RimP_N" amino acids 1 to 72 (72 residues), 101.5 bits, see alignment E=2.7e-33 PF17384: DUF150_C" amino acids 75 to 140 (66 residues), 82.9 bits, see alignment E=1.5e-27

Best Hits

Swiss-Prot: 100% identical to RIMP_SALPK: Ribosome maturation factor RimP (rimP) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: K09748, ribosome maturation factor RimP (inferred from 100% identity to sed:SeD_A3645)

Predicted SEED Role

"FIG000325: clustered with transcription termination protein NusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>GFF1496 FIG000325: clustered with transcription termination protein NusA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MITAPVEALGYELVGIEFIRGRTSTLRIYIDSEDGINVDDCADVSHQVSAVLDVEDPISV
AYNLEVSSPGLDRPMFTADHYARFQGEEVALVLRMAVQNRRKWQGIIKAVDGEMITVTVE
GKDEVFALSNIQKANLVPHF