Protein Info for PS417_07605 in Pseudomonas simiae WCS417

Annotation: CDP-glycerol--UDP-pyrophosphoryl-N- acetylglucosaminyl-N-acetylmannosamine glycerophosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF03846: SulA" amino acids 56 to 129 (74 residues), 31.8 bits, see alignment E=6.6e-12

Best Hits

Swiss-Prot: 68% identical to SULA_PSEAE: Cell division inhibitor SulA (sulA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K13053, cell division inhibitor SulA (inferred from 98% identity to pfs:PFLU1559)

Predicted SEED Role

"Cell division inhibitor-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEP5 at UniProt or InterPro

Protein Sequence (157 amino acids)

>PS417_07605 CDP-glycerol--UDP-pyrophosphoryl-N- acetylglucosaminyl-N-acetylmannosamine glycerophosphotransferase (Pseudomonas simiae WCS417)
MQLVHTPQHTQLSLFEAFMAQPLAPILKETVEAPWSAEPEAFSELSLRGAAGSCLSLLAP
ILRELSEEQDARWLTLIAPPASLTQAWLRDAGLNRERILLLQPRGAQSAQQLTCEALRLG
RSHTVVSWLNPLSVSAKQQLISAARTGDAQSLNIRLG