Protein Info for GFF1489 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sensory box histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 883 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details PF13426: PAS_9" amino acids 274 to 373 (100 residues), 15.1 bits, see alignment E=6.9e-06 amino acids 400 to 502 (103 residues), 41.3 bits, see alignment E=5e-14 TIGR00229: PAS domain S-box protein" amino acids 281 to 379 (99 residues), 41.5 bits, see alignment E=6.5e-15 amino acids 405 to 510 (106 residues), 73.3 bits, see alignment E=1e-24 PF08447: PAS_3" amino acids 283 to 368 (86 residues), 65 bits, see alignment E=1.9e-21 amino acids 412 to 492 (81 residues), 32.7 bits, see alignment E=2.2e-11 amino acids 538 to 607 (70 residues), 26.8 bits, see alignment E=1.5e-09 PF00989: PAS" amino acids 292 to 372 (81 residues), 23 bits, see alignment E=2.1e-08 amino acids 408 to 500 (93 residues), 34.1 bits, see alignment E=7.4e-12 PF08448: PAS_4" amino acids 409 to 503 (95 residues), 30.3 bits, see alignment E=1.3e-10 PF00512: HisKA" amino acids 665 to 730 (66 residues), 59.7 bits, see alignment 7e-20 PF02518: HATPase_c" amino acids 774 to 882 (109 residues), 82 bits, see alignment E=1.3e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (883 amino acids)

>GFF1489 Sensory box histidine kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKPVARLLSVPARWLAPLLLAAFALMTTGVNLFLEWQEVDQQVVESESRRLRERLGVEQS
RLSVETGNANTLLVRRLVGGLGLYSGIRHAYLIDARGVVLASLMRADIGQPFVDLQSLYP
ELAGVTPLFAEPMAGATLQVARPTGSALLFGRASLEPGNELLTVVDLSQPMAVRFAGMRA
QALREGVVLLVLVFLLALLLHWVWFRRAEQLARALTTMGEGQLQARTGLQGRDELALIGA
AADRMAERLQASHAQLQRMNDVVDRSPLVVIEWDNVVGCPIRYVSPSIAQWGYAPEPLLQ
GRMTYDDLIHPDDVGQVNAEIDDYLRHGPDQYRQEYRLRCADGRWIWIDDRSALTRNAQG
GVTAISGVLLDITVQKEAQIAQREQAEFQRLFYELPLIGMAISSPQSTHWLQVNDRLCEI
LGYSRDELLRVTWSEMTPSPDLERNLALLDRMKAGLTDSYQMQKRFRRRDGSFVQTEIHV
RAVREPDGALKHLFSIIQDITERLQTSQALSDQKGLLEQAEAMAGLGSWLYDSHTKHIWW
SRQMYRNIGRDMALGPPPTLKDYLDCLHPEDRDRVARFMQALPSNRGRLHAEFRRHPSLG
PERWFRGGVECRVLAENAGHHYSGTLLDITQIKQAQMNLERINARLEQRVAERTEQLSVA
NRELEAFSYTVSHDLKAPLRGIDGYSQLLQEEHGDQLNDEGRQFIGRIRRGVQQMGALIS
DLLDYSRMERRPMEHQAVELRPLLDLVIEGHAADIAAAGTALSLQLEPMTMRLDREGLAV
VLRNLVGNAIKFSQSRSQPRVEIGSRSEAGRRILWVRDNGVGFDMKYHDRIFGIFQRLQR
AEDYAGTGVGLALVAKAVQRMGGRVWAESAPGEGATFYLEFPS