Protein Info for GFF1488 in Variovorax sp. SCN45

Annotation: Tetrapartite efflux system, membrane fusion component FusE-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 20 to 20 (1 residues), see Phobius details transmembrane" amino acids 21 to 39 (19 residues), see Phobius details PF25917: BSH_RND" amino acids 58 to 210 (153 residues), 45.7 bits, see alignment E=7.3e-16 PF25963: Beta-barrel_AAEA" amino acids 214 to 309 (96 residues), 107.9 bits, see alignment E=3.4e-35

Best Hits

Swiss-Prot: 37% identical to AAEA_YERPB: p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) from Yersinia pseudotuberculosis serotype IB (strain PB1/+)

KEGG orthology group: None (inferred from 73% identity to vap:Vapar_4318)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>GFF1488 Tetrapartite efflux system, membrane fusion component FusE-like (Variovorax sp. SCN45)
MKTDALPLPAWAFRSARSTARLLFTLTIVAASCWAAWQLWDHYELAPWTRNGRVRADVVQ
VAPDVSGLVSDVAVRDNQSVAAGALLFAVDRARFELAEQQAEAAVAAQAASVGNQRILIA
QAHRENNRNSGLGDLVSQEVREQSRLRLDQANSALRSAEAALRQAQVALDTARLNLRRTE
VRAPTAGLVTNLDLRQGAYASAGHPVMALVDADSVYVEGYFEENKLARIHLGDRVRVTPM
DADAIEGAVESIAAGIADRDRSIGANLLPSVNPTFNWVRLAQRVPVRVKLGAIPAGTRLV
TGQTVTVQVLGASAASAASEAAAAARRSERRG