Protein Info for GFF1488 in Sphingobium sp. HT1-2

Annotation: diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 TIGR00229: PAS domain S-box protein" amino acids 157 to 281 (125 residues), 56.2 bits, see alignment E=3.9e-19 amino acids 283 to 411 (129 residues), 44.5 bits, see alignment E=1.6e-15 PF08448: PAS_4" amino acids 172 to 275 (104 residues), 31.7 bits, see alignment E=3.9e-11 PF00989: PAS" amino acids 175 to 272 (98 residues), 35.7 bits, see alignment E=1.9e-12 amino acids 287 to 402 (116 residues), 26.7 bits, see alignment E=1.2e-09 PF13426: PAS_9" amino acids 178 to 273 (96 residues), 20.1 bits, see alignment E=1.6e-07 PF08447: PAS_3" amino acids 186 to 268 (83 residues), 67.2 bits, see alignment E=3.1e-22 amino acids 311 to 398 (88 residues), 36.2 bits, see alignment E=1.5e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 413 to 576 (164 residues), 119.3 bits, see alignment E=1.4e-38 PF00990: GGDEF" amino acids 416 to 573 (158 residues), 129.7 bits, see alignment E=2.2e-41

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (627 amino acids)

>GFF1488 diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (Sphingobium sp. HT1-2)
MDRFADRRFADGARELGGPAAHMPSGANVAHRTLCAKIKHVRPPVIHWFADYRGRLLTYW
VEGEVRGGGLRMGLMRHGWRKGFDSVDIGIIIRAAAASSQPEPLVVRLRCADGASRWCLL
RMTRQAMPAGAWRWYGTVEDMHDRRDKQAELLETALAESREHHRWSVELSPQVPWTATPD
GAIEEVGPRWRDLTGSSPEQAMGAGWINALHPDDMDRTLALWRERLQSGDPVDVDYRLRL
RDGSYRWMRARAAARRDGKGAIIRWYGTLEDIHNQKLAQQAVAESEEHFRLAVQSARLGI
WDYDARSGQRSWSAEFRAMLGLTADAPATTELALSLVHPDDRHKLKAMMDGVAANVLPPH
FEATLRVHRADNGALRWIRSTGWATRTEVGQLRRIIVTFLDVTEQRDAEERIRWAATHDP
MTRLPNRTLWQGVLEELADQARPTGAGFGLMLFDIDDLKRINDSLGHDAGDALLCGFAER
LAAAAPADAVVGRLGGDEFGLIAASLLDSATVQACSQAILDKMRVPFAYQGQLLEAGVSV
GGAVFGEHGDDAHELFKAADLALYASKASGRSRLTMFHSQLRADAQQRSSMIHMARQVIA
ERLVEPYYQPKVDMRSGQVLGYEALLR