Protein Info for GFF1486 in Methylophilus sp. DMC18

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF00135: COesterase" amino acids 58 to 163 (106 residues), 59.8 bits, see alignment E=6.6e-20 PF20434: BD-FAE" amino acids 58 to 246 (189 residues), 112 bits, see alignment E=7.8e-36 PF07859: Abhydrolase_3" amino acids 74 to 263 (190 residues), 69.8 bits, see alignment E=7.5e-23 PF00326: Peptidase_S9" amino acids 129 to 291 (163 residues), 51.7 bits, see alignment E=2.1e-17

Best Hits

KEGG orthology group: None (inferred from 48% identity to mep:MPQ_1658)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>GFF1486 hypothetical protein (Methylophilus sp. DMC18)
MPMNLQNPQLTRRSWLTGLAGLLLSACRPVTLLNAVIPDKGMRIHRDIAFGPHSRQRLDI
YQPRDHAATPRPVVLFFYGGSWESGSKQDYLFVAEALTSQGMLVVIADYRLYPELKFPQL
MQDPALALQWVKQHVAEYQGDASRVFLMGHSAGAHLAVMLTLNAAYLAAVGLSPTAIKGT
IGLAGPYDFLPLTSDTLRAIFAPAEQEWQSQPIRFVSGQHPPLLLLAGLKDQTVWPRNSI
NLARALEAQGSEVKLLTYANYNHVDMVAKLARPLRGNSPLLQDICDWIGQHASA