Protein Info for GFF1485 in Xanthobacter sp. DMC5

Annotation: Lactose transport system permease protein LacG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 84 to 111 (28 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 103 to 283 (181 residues), 66.7 bits, see alignment E=1.2e-22

Best Hits

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 64% identity to amv:ACMV_33450)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>GFF1485 Lactose transport system permease protein LacG (Xanthobacter sp. DMC5)
MTGAADLRARLRGNFVAGNLVAHAVLLLGTALFLLPIWLVFVGSTLDSGAINRGEIGLLP
RLEGLAIYPRLLSPAPGGVPVWRMLALSFAMALAIAVGKIAVSLLSAYAVAFFRFPGRML
CFWLLFITLMLPVEVRIIPTFAVVADFGLVNSFAGLVLPLTASATATLLFRQAFVLVPDE
LVEAARMDGAGPWRFLRDVLIPLSRTNMAALFVILFVYGWNQYLWPLVVATDPRLDTITV
GIVRMIGPESRTAWNEVMATAILAMLPPTLVVLAMLRWFVKGLTESER