Protein Info for GFF1485 in Methylophilus sp. DMC18

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 13 to 172 (160 residues), 34.8 bits, see alignment E=1.3e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 223 to 388 (166 residues), 166 bits, see alignment E=3.2e-53 PF00990: GGDEF" amino acids 225 to 384 (160 residues), 149.1 bits, see alignment E=9.7e-48

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF1485 hypothetical protein (Methylophilus sp. DMC18)
MSIRRRKAVLYILVAGFMIVLIGVLLFLWIYFSSMREMHQTTRNFYEQSFTVSNAAQALE
SQLHQIRSDLLYATLIQADSVHLINTVAAIKGHEAAAQQKIASIERNYSGDRAPLPLLKQ
NIQALDEMTASVIKQLAEGRYTEASTLIETAWNARFAKVAKLNEAILAHADLRANEYVAE
SEKRMERHTHQGITYAALLVTLFLLVGLFVGGRIYHLHLEADKFAFTDFLTGIANRRHFI
HELESEIRRYQRYGSSFSFAMVDIDFFKKINDQYGHHAGDLVLQNFCLRCVSALRTSDMV
GRLGGEEFGILMPMTDLHEAAHVIERLRSEIDHSVMSEQGEQIHYTASFGLVSTAQLGTQ
DGLTQLMKMADFALYTAKQQGRNRVYIANH