Protein Info for GFF1483 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 TIGR02951: dimethylsulfoxide reductase, chain B" amino acids 3 to 163 (161 residues), 278.3 bits, see alignment E=1e-87 PF13247: Fer4_11" amino acids 59 to 153 (95 residues), 95.9 bits, see alignment E=5.2e-31 PF12838: Fer4_7" amino acids 66 to 113 (48 residues), 28.4 bits, see alignment 6.5e-10 PF00037: Fer4" amino acids 92 to 114 (23 residues), 25.5 bits, see alignment (E = 3.1e-09)

Best Hits

Swiss-Prot: 59% identical to DMSB_SHIFL: Anaerobic dimethyl sulfoxide reductase chain B (dmsB) from Shigella flexneri

KEGG orthology group: K07307, anaerobic dimethyl sulfoxide reductase subunit B (DMSO reductase iron- sulfur subunit) (inferred from 100% identity to sec:SC4184)

MetaCyc: 59% identical to dimethyl sulfoxide reductase subunit B (Escherichia coli K-12 substr. MG1655)
DIMESULFREDUCT-RXN [EC: 1.8.5.3]

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>GFF1483 Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKQYGFYVDSSRCSGCKTCQVSCKDNKDLDVGPKLRRVYEYGGGSWVKEGESWHHDTFTY
YLSIACNHCDEPVCVSGCPTGAMHKRKEDGLVVVDDSVCVGCRYCEMRCPYGAPQFDTQA
NVMRKCDGCLDRLENNLRPICVDSCPQRALDFGPVDELRAKYGTENQIAPLPSASFTHPN
LIIKPHPKARPTGDTEGAIMNIREVRHA