Protein Info for GFF1481 in Variovorax sp. SCN45

Annotation: L-carnitine dehydratase/bile acid-inducible protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF02515: CoA_transf_3" amino acids 17 to 383 (367 residues), 426.6 bits, see alignment E=4.4e-132

Best Hits

Swiss-Prot: 44% identical to SUCHY_RAT: Succinate--hydroxymethylglutarate CoA-transferase (Sugct) from Rattus norvegicus

KEGG orthology group: None (inferred from 62% identity to axy:AXYL_01736)

MetaCyc: 45% identical to succinyl-CoA-glutarate CoA-transferase (Pseudomonas putida)
Succinate--hydroxymethylglutarate CoA-transferase. [EC: 2.8.3.13]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>GFF1481 L-carnitine dehydratase/bile acid-inducible protein F (Variovorax sp. SCN45)
MYKYFLETDMANPELPLAGVRVLDLTRALAGPFCTMVLADLGADVIKVEPMGGDMIRNWG
PFDRGTSAYYLSGNRNKRGVALNFRDPRAIRLLGEMASQCDVVAENFRPGAMDSMGLSYE
SLRERNRGLVYASITGFGRTGPAGQRPGFDQIAQGYSGLMSVTGSEESGPMRVGVAIGDQ
TAGMWCAIGVLAALNQRQRTGEGQRVETSLLGGLVGLLSVQGQRYLSLGEIPKLAGNVHP
VISPYGVFEAADGPLNIAPATTDMWHKLCALLGLGHLIDDPRFATNAKRVERRQELKQLI
EGKLKSNTRETWTRLLIEAEIPAGPINDLADVFNDAQVQHSRFVEEIEHPELGTVRQVGS
PIKLEAMEGGSIRRAPPLLGQHTCEVLREFGCSQNEIDTLLADGAAAQSAAAHA