Protein Info for GFF1471 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Arginine/agmatine antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 203 to 227 (25 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 329 to 351 (23 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details amino acids 387 to 404 (18 residues), see Phobius details PF00324: AA_permease" amino acids 1 to 355 (355 residues), 107.5 bits, see alignment E=7e-35 PF13520: AA_permease_2" amino acids 2 to 379 (378 residues), 169.8 bits, see alignment E=1e-53

Best Hits

Swiss-Prot: 100% identical to ADIC_SALTY: Arginine/agmatine antiporter (adiC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03759, arginine:agmatine antiporter (inferred from 99% identity to ses:SARI_03363)

MetaCyc: 94% identical to arginine:agmatine antiporter (Escherichia coli K-12 substr. MG1655)
RXN0-2162

Predicted SEED Role

"Arginine/agmatine antiporter" in subsystem Acid resistance mechanisms or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>GFF1471 Arginine/agmatine antiporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MGSGVFLLPANLAATGGIAIYGWLVTIIGALALSMVYAKMSSLDPSPGGSYAYARRCFGP
FLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFPILKDPLVLTLTCVAVLWIFVLLNIVG
PKMITRVQAVATVLALVPIVGIAVFGWFWFKGETYMAAWNVSGMNTFGAIQSTLNVTLWS
FIGVESASVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFG
DAARMALGDTAGAIVSFCAAAGCLGSLGGWTLLAGQTAKAAADDGLFPPIFARVNKAGTP
VAGLLIVGVLMTIFQFSSMSPNAAKEFGLVSSVSVIFTLVPYLYTCAALLLLGHGHFGKA
RPLYLLITFVAFVYCIWAVIGSGAKEVMWSFVTLMVITALYALNYNRIHKNPYPLDAPVK
QD