Protein Info for GFF1468 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Sensor protein basS/pmrB (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details PF00672: HAMP" amino acids 91 to 140 (50 residues), 24.7 bits, see alignment 4.7e-09 PF00512: HisKA" amino acids 147 to 203 (57 residues), 42.9 bits, see alignment E=8.4e-15 PF02518: HATPase_c" amino acids 252 to 358 (107 residues), 76.2 bits, see alignment E=5.6e-25

Best Hits

Swiss-Prot: 100% identical to BASS_SALTY: Sensor protein BasS (basS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07643, two-component system, OmpR family, sensor histidine kinase BasS [EC: 2.7.13.3] (inferred from 99% identity to stt:t4198)

MetaCyc: 86% identical to sensor histidine kinase BasS (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensor protein basS/pmrB (EC 2.7.3.-)" in subsystem Lipid A modifications or Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>GFF1468 Sensor protein basS/pmrB (EC 2.7.3.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VSLMRFQRRAMTLRQRLMLTIGLILLVFQLISTFWLWHESTEQIQLFEQALRDNRNNDRH
IMHEIREAVASLIVPGVFMVSLTLLICYQAVRRITRPLAELQKELEARTADNLAPIAIHS
STLEIESVVSAINQLVTRLTTTLDNERLFTADVAHELRTPLSGVRLHLELLSKTHNVDVA
PLIARLDQMMDSVSQLLQLARVGQSFSSGNYQEVKLLEDVILPSYDELNTMLETRQQTLL
LPESAADVVVRGDATLLRMLLRNLVENAHRYSPEGTHITIHISADPDAIMAVEDEGPGID
ESKCGKLSEAFVRMDSRYGGIGLGLSIVSRITQLHQGQFFLQNRTERTGTRAWVLLKKA