Protein Info for GFF1464 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 229 to 232 (4 residues), see Phobius details amino acids 255 to 272 (18 residues), see Phobius details amino acids 302 to 327 (26 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details amino acids 396 to 419 (24 residues), see Phobius details amino acids 426 to 451 (26 residues), see Phobius details amino acids 486 to 508 (23 residues), see Phobius details amino acids 532 to 554 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 279 (198 residues), 48 bits, see alignment E=6.2e-17 amino acids 392 to 552 (161 residues), 34.1 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 84% identity to vpe:Varpa_2116)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (563 amino acids)

>GFF1464 hypothetical protein (Variovorax sp. SCN45)
MRARIPNRMGDPAVWLFGTLILLLILLVANPILRLIWDSFHTADGTLSFSSYAAALGRSR
NLQALLNSFYLGVAVTAIAIALGVPLALAVSRTNMPARGFTHVSVLAAFVMPNFLGAIAW
ILLAGPNAGWLNRLWSEVLGTDRGPFNIFSFWGLAFVIALYTYPLIYVFTKSALDLVSTE
LEDAASIHGAGKLRTLTRVTLPLVLPSIVGAAILIFLESVALYGTPALIAIPAGLNLATT
QIVSFFEYPLKVEQAAAFSMPILALTVVMLYLQRRLLARKGFVSVSGKGGERRPFDVGAW
KWVLLGYSALVSLLTVVMPLIILVLASLSKAWGRGFSAGNLTFANFYNIFFEQLTVRSAL
VNTVTYSAVTALVCVAMGMCVAYATQRRITPFPTLIQFLALAPVAVPGLILAIGLYAAYA
GPPFSLYGTGALVVVAFTTRFLPIAVTACGAGVRSLNPELEEAVRILGGGRLTALGKVVV
PLLNKTLVGAFILVFVICTKELSTAVFLTGPASRVVSVLTLDLSEQGNYESLAAMGVVLV
VIVTLVVGIGMRIAGRDFMLRRS