Protein Info for GFF1464 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PhnO protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00583: Acetyltransf_1
  • amino acids 30 to 133 (104 residues), 67 bits, E=2.8e-22
• PF13673: Acetyltransf_10
  • amino acids 37 to 137 (101 residues), 41.6 bits, E=1.8e-14
• PF13508: Acetyltransf_7
  • amino acids 48 to 134 (87 residues), 53.3 bits, E=4.5e-18

Best Hits

Swiss-Prot: 100% identical to PHNO_SALTY: Aminoalkylphosphonate N-acetyltransferase (phnO) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K09994, PhnO protein [EC: 2.3.1.-] (inferred from 96% identity to sew:SeSA_A4542)

MetaCyc: 77% identical to aminoalkylphosphonate N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-17960 [EC: 2.3.1.280]; 2.3.1.280 [EC: 2.3.1.280]; 2.3.1.280 [EC: 2.3.1.280]; 2.3.1.280 [EC: 2.3.1.280]; 2.3.1.- [EC: 2.3.1.280]

Predicted SEED Role

"PhnO protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• (aminomethyl)phosphonate degradation (3/8 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.280

Protein Sequence (144 amino acids)

>GFF1464 PhnO protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPVCELRHATTEDTDSVYALICELLKNELDYQAFRDGFAANLLDPNVHYRLALRNGEVVG
MISLHMQFHLHHANWIGEIQELVVLPPMRGQKIGSQLLAWAEEEARQAGAELTELSTNIK
RRDAHRFYLREGYKQSHFRFTKAL